PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00008920001
Common NameGSBRNA2T00008920001, LOC106398373
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 341aa    MW: 38752.9 Da    PI: 5.473
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00008920001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1017.7e-32171226156
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                          k+r++W+++LH+rF++a+++LGG+++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  GSBRNA2T00008920001 171 KQRRCWSSQLHRRFLNALQHLGGPHVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 226
                          79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.613168228IPR017930Myb domain
SuperFamilySSF466894.18E-17169229IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.0E-27169229IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-28171226IPR006447Myb domain, plants
PfamPF002496.1E-6173224IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 341 aa     Download sequence    Send to blast
MDYNQERCGQ YIEALEEERR KILVFQRELP LCLDLVTQAI ERCKKEITET ATDNVYGQSE  60
CSEQTTGQCT PVLEQFLTIK DSSTFNEEEV EEEFEDEQGN HDPENDSEDK IMKSDWLKSV  120
QLWNQPDPLL PKEEQSQQMM ETVVKRDESM REDANAMANS GERRRRETER KQRRCWSSQL  180
HRRFLNALQH LGGPHVATPK QIRELMKVDG LTNDEVKSHL QKYRLHTRRP SQTVPNNGNS  240
QKQHFVVVGG LWVPQSDYSS GKTTGRATTS GTTTTTTTTT TNGIYGAMAA PPPPQWPSHF  300
NFTPSIIVEE GSGSHSEEVV VRCSSPAMSS STRNYHVTKN *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1161166ERRRRE
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00008920001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013694396.10.0PREDICTED: two-component response regulator-like APRR2
TrEMBLA0A078G2Y20.0A0A078G2Y2_BRANA; BnaC05g08910D protein
STRINGBra019824.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM135081728
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13300.11e-151G2-like family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]